These proteins consist of 4 hydrophobic transmembrane domains, 2 extracellular loops and short cytoplasmic tails at N and C-termini containing YV and PDZ-domain binding motifs. Claudin 14, a 25kD glycoprotein, is a novel member of this family. It is a vital component of inner ear tight junction strands. Its expression has been observed in sensory epithelium of inner organ of Corti, vestibular system, kidney and Liver. Mutations in Claudin 14 cause a congenital autosomal recessive form of nonsyndromic sensorineural deafness in humans.

Suitable for use in FLISA and Immunoprecipitation. Other applications not tested.

Optimal dilutions to be determined by the researcher.

HWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPQDLQAAR

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa29-82 from CLDN14 with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.

Purified by Protein A affinity chromatography.

Recognizes human CLDN14.