Mouse Anti-CLDN14 (Claudin-14, UNQ777/PRO1571)
These proteins consist of 4 hydrophobic transmembrane domains, 2 extracellular loops and short cytoplasmic tails at N and C-termini containing YV and PDZ-domain binding motifs. Claudin 14, a 25kD glycoprotein, is a novel member of this family. It is a vital component of inner ear tight junction strands. Its expression has been observed in sensory epithelium of inner organ of Corti, vestibular system, kidney and Liver. Mutations in Claudin 14 cause a congenital autosomal recessive form of nonsyndromic sensorineural deafness in humans.
Applications
Suitable for use in ELISA and Immunoprecipitation. Other applications not tested.
Recommended Dilutions
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
HWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPQDLQAAR
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa29-82 from human CLDN14 with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CLDN14.
