125079
Clone Type
MonoclonalHost
MouseSource
HumanIsotype
IgG2a,kClone Number
3F8Grade
Affinity PurifiedApplications
E IF IHC IP WBCrossreactivity
HuAccession #
NM_004669, NP_004660Shipping Temp
Blue IceStorage Temp
-20°CMouse Anti-CLIC3 (Chloride Intracellular Channel Protein 3)
Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 3 is a member of the p64 family and is predominantly localized in the nucleus and stimulates chloride ion channel activity. In addition, this protein may participate in cellular growth control, based on its association with ERK7, a member of the MAP kinase family.
Applications
Suitable for use in ELISA, Immunoprecipitation, Immunofluorescence, Immunohistochemistry and Western Blot. Other applications not tested.
Recommended Dilutions
Immunofluorescence: 15ug/ml Immunohistochemistry (FFPE): 3ug/ml Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
RLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa137-236 from human CLIC3 with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CLIC3.
