125104-Biotin
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
BiotinIsotype
IgG1,kClone Number
1A11Grade
Affinity PurifiedApplications
E WBCrossreactivity
HuAccession #
NM_001831, NP_001822Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-Clusterin (AAG4, APOJ, Apo-J, Apolipoprotein J, CLI, Clusterin precursor, Complement-associated protein SP-40,40, Complement cytolysis inhibitor, KUB1, MGC24903, NA1/NA2, SGP2, SGP-2, SP-40, Testosterone-repressed prostate message 2, TRPM2, TRPM-2) (Biotin)
Clusterin is an ubiquitously expressed protein of two 40kD chains, alpha and beta, covalently joined by disulfide bonds. It exists in two forms; a pro-apoptotic form localized to the nucleus and a pro-survival secreted form. Both are thought to be involved in DNA repair and cell cycle regulation. The secreted form is thought to inhibit apoptotic signalling by BAX, Clusterin suppression can sensitise cells to chemotherapy. Clusterin is overexpressed in human prostate cancer, breast cancers and squamous cell carcinomas. Part of the SC5b-9 complex, clusterin prevents the binding of a C5b-C7 complex to the membrane of the target cell inhibiting the complement cascade. Clusterin acts as an extracellular chaperone inhibiting the formation of human lysozyme amyloid associated with Alzheimer's disease. Clusterin is also important in spermatogenesis and is secreted by Sertoli cells.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
WKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa402-501 from human CLU (NP_001822) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CLU.
