125223-ML650
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
MaxLight™650Isotype
IgG2a,kClone Number
4B12Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
Hu Mo RtAccession #
NM_004236, NP_004227Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-COPS2 (COP9 Signalosome Complex Subunit 2, ALIEN, COP9 Constitutive Photomorphogenic Homolog Subunit 2, CSN2, JAB1-containing Signalosome Subunit 2, Signalosome Subunit 2, SGN2, Thyroid Receptor-interacting Protein 15, TR-interacting Protein 15, TRIP 15, TRIP15, TRIP-15) (MaxLight 650)
MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
Alien is a novel co-repressor that interacts with the thyroid hormone receptor in the absence of hormone. Alien is highly conserved between human and Drosophila and is specific for selected members of the nuclear hormone receptor superfamily.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
REHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa344-443 from COPS2 (NP_004227) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human COPS2. Species Crossreactivity: mouse and rat.