125236-ML550
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
MaxLight™550Isotype
IgG2a,kClone Number
6F11Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
NM_001264, NP_001255Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-Corneodesmosin (CDSN, S Protein) (MaxLight 550)
MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
CDSN (Corneodesmosin; also S protein) is a 52-56kD, secreted glycoprotein that has an unusually high content of Gly, Pro and Ser. It is found in the desmosomes of spinous layer keratinocytes, and presumably uses its high Gly content to generate homophilic noncovalent intercellular bridges. Mature human CDSN is 497aa in length. It contains a Ser-rich region (aa62-464) and one Gly-rich domain (aa60-171). CDSN undergoes sequential proteolytic processing to generate multiple fragments that vary in size from 46-43kD, to 35-30kD, to 15kD. This sequential extracellular processing allows initially for CDSN incorporation into a functional adhesional junction, and later for the removal of adhesional glycine loops with a subsequent dissociation (desquamation) of cells. There is one potential isoform termed the S protein that shows a two aa substitution for the C-terminal 29aa. Over aa33-529, human CDSN shares 68% aa identity with mouse CDSN.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
YLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNP
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa306-355 from human CDSN (NM_001264, NP_001255) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CDSN.