125344-ML550
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
MaxLight™550Isotype
IgG2a,kClone Number
4A11Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
NM_022148, NP_071431Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-CRLF2 (Cytokine Receptor-like Factor 2, Cytokine Receptor-like 2, IL-XR, Thymic Stromal Lymphopoietin Protein Receptor, TSLP Receptor, CRL2, ILXR, TSLPR) (MaxLight 550)
MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
TSLP receptor is a member of the hematopoietin receptor family which acts as a receptor for the cytokine thymic stromal lymphopoietin (TSLP) that promotes CD4(+) T cell homeostasis and contributes to allergic and inflammatory responses. TSLP receptor is a heterodimeric complex, consisting of the IL-7R-alpha chain and a common gamma-like receptor chain. The protein contains two fibronectin type III-like domains, four conserved cysteine residues, and a WSXWS box-like motif at it's N-terminal, while the C-terminal intracellular region contains box 1 and box 2-like motifs. The protein is usually expressed in liver, kidney, heart, and skeletal muscle. The gene for human TSLP receptor is localized to the pseudoautosomal region, Xp22.3 and Yp11.3.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
QGGAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQD
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa23-133 from human CRLF2 (NP_071431) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CRLF2.