125351-PE
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
PEIsotype
IgG2a,kClone Number
4H6Grade
Affinity PurifiedApplications
FLISACrossreactivity
HuAccession #
NM_004830, NP_004821Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
BSA Free
Mouse Anti-CRSP3 (Mediator of RNA Polymerase II Transcription Subunit 23, Activator-recruited Cofactor 130kD Component, ARC130, Cofactor Required for Sp1 Transcriptional Activation Subunit 3, CRSP Complex Subunit 3, Mediator Complex Subunit 23, Protein Sur-2 Homolog, hSur-2, Transcriptional Coactivator CRSP130, Vitamin D3 Receptor-interacting Protein Complex 130kD Component, DRIP130, ARC130, MED23, DRIP130, KIAA1216, SUR2) (PE)
Required for transcriptional activation subsequent to the assembly of the preinitiation complex By similarity. Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Required for transcriptional activation by adenovirus E1A protein. Required for ELK1-dependent transcriptional activation in response to activated Ras signaling.
Applications
Suitable for use in FLISA. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
LTVHAKMSLIHSIATRVIKLAHAKSSVALAPALVETYSRLLVYMEIESLGIKGFISQLLPTVFKSHAWGILHTLLEMFSYRMHHIQPHYRVQLLSHLHTL
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa531-630 from CRSP3 (NP_004821) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CRSP3.
