Mouse Anti-CSPG5 (CALEB, NGC, Chondroitin Sulfate Proteoglycan 5, Acidic Leucine-rich EGF-like Domain-containing Brain Protein, Neuroglycan C, MGC44034)
CSPG5 may function as a growth and differentiation factor involved in neuritogenesis. May induce ERBB3 activation.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilutions
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
KKLYLLKTENTKLRRTNKFRTPSELHNDNFSLSTIAEGSHPNDDPSAPHKIQEVLKSCLKEEESFNIQNSMSPKLEGGKGDQADLDVNCLQNNLT
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa445-539 from human CSPG5 with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CSPG5.
