Mouse Anti-CTNND2 (Catenin delta-2, Delta-catenin, GT24, Neural Plakophilin-related ARM-repeat Protein, NPRAP, Neurojungin, NPRAP)
Catenin delta-2 functions as a transcriptional activator when bound to ZBTB33. It may also be involved in neuronal cell adhesion and tissue morphogenesis and integrity by regulating adhesion molecules. It is predominantly expressed in the brain and localises to the nucleus and cell junction. The unprocessed precursor has a length of 1225aa and a predicted molecular weight of 132.7kD. This protein is O-glycosylated. It is also phosporylated upon DNA damage. It belongs to the beta-catenin family and contains nine ARM repeats.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
ISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLYRNSYGAPAEDIKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLG
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa1081-1190 from human CTNND2 (NP_001323) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CTNND2. Species Crossreactivity: rat.
