125491-Biotin
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
BiotinIsotype
IgG1,kClone Number
1D6Grade
Affinity PurifiedApplications
E WBCrossreactivity
HuAccession #
BC001163, AAH01163Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-CX3CL1 (Fractalkine, C-X3-C Motif Chemokine 1, CX3C Membrane-anchored Chemokine, Neurotactin, Small-inducible Cytokine D1, FKN, NTT, SCYD1, A-152E5.2) (Biotin)
Fractalkine, also known as neurotactin, is a membrane-bound CX3C Chemokine. The mature protein is part of a 397aa precursor and consists of a chemokine domain of 76aa, a mucin stalk of 241aa, a putative transmembrane domain of 18aa, and an intracellular tail of 37aa. Within the chemokine domain, the first two cysteine residues are separated by 3aa (CX3C). Fractalkine message is found in high abundance in the brain, kidney, lung and heart tissues. Fractalkine is chemotactic for monocytes and other leukocytes including NK cells and may play a role in brain inflammation.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
HHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLEPEATGES
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa26-136 from human CX3CL1 (AAH01163) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CX3CL1.