125688-ML650
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
MaxLight™650Isotype
IgG2b,kClone Number
3D7Grade
Affinity PurifiedApplications
FLISA IF WBCrossreactivity
Hu Mo RtAccession #
NM_020640, NP_065691Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-DCUN1D1 (DCN1-like Protein 1, DCUN1 Domain-containing Protein 1, Defective in Cullin Neddylation Protein 1-like Protein 1, Squamous Cell Carcinoma-related Oncogene, DCUN1L1, RP42, SCCRO) (MaxLight 650)
MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
Part of an E3 ubiquitin ligase complex for neddylation. Required for neddylation of cullin components of E3 cullin-RING ubiquitin ligase complexes by enhancing the rate of cullins neddylation. Functions to recruit the NEDD8-charged E2 enzyme to the cullin component. Involved in the release of inhibitory effets of CAND1 on cullin-RING ligase E3 complex assembly and activity. Acts also as an oncogene facilitating malignant transformation and carcinogenic progression.
Applications
Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQF
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-90 from human DCUN1D1 (NP_065691) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human DCUN1D1. Species Crossreactivity: mouse and rat.
