125789-ML490
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
MaxLight™490Isotype
IgG2a,kClone Number
4C1Grade
Affinity PurifiedApplications
FLISACrossreactivity
HuAccession #
NM_032564, NP_115953.2Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-DGAT2 (Diacylglycerol O-acyltransferase 2, Acyl-CoA Retinol O-fatty-acyltransferase, ARAT, Retinol O-fatty-acyltransferase, Diglyceride Acyltransferase 2, HMFN1045, UNQ738/PRO1433, DKFZp686A15125) (MaxLight 490)
MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.
Essential acyltransferase that catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. Required for synthesis and storage of intracellular triglycerides. Probably plays a central role in cytosolic lipid accumulation. In liver, is primarily responsible for incorporating endogenously synthesized fatty acids into triglycerides. Functions also as an acyl-CoA retinol acyltransferase (ARAT).
Applications
Suitable for use in FLISA. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
IFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa289-389 from human DGAT2 (NP_115953) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human DGAT2.
