Mouse Anti-DHX8 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 8, DEAH Box Protein 8, DHX-8, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 8, DDX8, DDX-8, HRH1, Human RNA Helicase 1, PRP22, PRPF22)
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is highly homologous to yeast Prp22. This protein facilitates nuclear export of spliced mRNA by releasing the RNA from the spliceosome.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
RREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKW
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa301-400 from human DHX8 (NP_004932) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human DHX8.
