125839-APC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
APCIsotype
IgG1,kClone Number
3G7Grade
Affinity PurifiedApplications
FLISA IF IHC WBCrossreactivity
HuAccession #
NM_001357, NP_001348Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
BSA Free
Mouse Anti-DHX9 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 9, DEAH Box Protein 9, DHX-9, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 9, DDX9, DDX-9, ATP-dependent RNA Helicase A, LKP, Nuclear DNA Helicase II, NDHII, NDH2, RNA Helicase A, RHA) (APC)
DHX9, otherwise known as ATP-dependent RNA helicase A, is a transcriptional activator and member of the DEAD box helicase family. DHX9 is a component of the coding region determinant (CRD)-mediated complex and exhibits RNA helicase activity, unwinding double-stranded DNA and RNA in a 3' to 5' direction.
Applications
Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml FLISA: The detection limit is ~3ng/ml as a capture antibody Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml stains DHX9 on human testis Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-90 from human DHX9 (NP_001348) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human DHX9.