125839
Clone Type
MonoclonalHost
MouseSource
HumanIsotype
IgG1,kClone Number
3G7Grade
Affinity PurifiedApplications
E IF IHC WBCrossreactivity
HuAccession #
NM_001357, NP_001348Shipping Temp
Blue IceStorage Temp
-20°CMouse Anti-DHX9 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 9, DEAH Box Protein 9, DHX-9, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 9, DDX9, DDX-9, ATP-dependent RNA Helicase A, LKP, Nuclear DNA Helicase II, NDHII, NDH2, RNA Helicase A, RHA)
DHX9, otherwise known as ATP-dependent RNA helicase A, is a transcriptional activator and member of the DEAD box helicase family. DHX9 is a component of the coding region determinant (CRD)-mediated complex and exhibits RNA helicase activity, unwinding double-stranded DNA and RNA in a 3' to 5' direction.
Applications
Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml ELISA: The detection limit is ~3ng/ml as a capture antibody Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml stains DHX9 on human testis Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa1-90 from human DHX9 (NP_001348) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human DHX9.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
References
1. Coordinate roles of Gag and RNA helicase A in promoting the annealing of tRNALys3 to HIV-1 RNA. Xing L, Liang C, Kleiman L.J Virol. 2010 Nov 24. [Epub ahead of print]. 2.Functional proteomic analysis of promyelocytic leukaemia nuclear bodies in irradiation-induced MCF-7 cells. Liu J, Song Y, Tian B, Qian J, Dong Y, Liu J, Liu B, Sun Z.J Biochem. 2010 Dec;148(6):659-67. Epub 2010 Sep 7. 3. RNA Helicase A Interacts with RISC in Human Cells and Functions in RISC Loading. Robb GB, Rana TM.Mol Cell. 2007 May 25;26(4):523-37.USBio References
No references available