125869-ML550
Clone Type
PolyclonalHost
RabbitSource
HumanConjugate
MaxLight™550Isotype
IgGGrade
Affinity PurifiedApplications
WBCrossreactivity
HuAccession #
NM_014420, NP_055235.1Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Rabbit Anti-DKK4 (Dickkopf-related Protein 4, Dickkopf-4, Dkk-4, hDkk-4) (MaxLight 550)
MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
DKK4, like DKK1, DKK2, and DKK3, possesses an N-terminal signal peptide and 2 conserved cysteine-rich domains, which are separated by a linker region and contain 10 cysteine residues each. The second cysteine region has a putative lipid-binding function that may facilitate WNT/DKK interactions at the plasma membrane. The linker region contains 50-55aa in DKK1, DKK2, and DKK4, whereas in DKK3 it contains only 12aa. All DKKs have several potential sites for cleavage by furin-type proteases. Northern blot analysis detected no expression of DKK4, but RT-PCR analysis detected DKK4 expression in cerebellum, T-cell, esophagus, and lung cDNA libraries. DKK4 blocks Xenopus Wnt8, Wnt3a, and Wnt2b, but not Dsh or Fz8, induction of a secondary axis in frog embryos, indicating that DKKs antagonize WNT function upstream of WNT receptors.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MVAAVLLGLSWLCSPLGALVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLRRRCQRDAMCCPGTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPGLLCRSQLTSNRQHARLRVCQKIEKL
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length human DKK4, aa1-224 (NP_055235.1).
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human DKK4.