Mouse Anti-DLL1 (Delta-like Protein 1, Drosophila Delta Homolog 1, Delta1, H-Delta-1, UNQ146/PRO172)
The Notch ligand delta-like protein 1 (DLL1) is essential for postnatal arteriogenesis and contributes to tumor progression. DLL1 is involved in differentiation and self-renewal of adipocyte stem cells. Blocks the differentiation of progenitor cells into the B cell lineage while promoting the emergence of a population of cells with the characteristics of a T-cell/NK-cell precursor.
Applications
Suitable for use in ELISA, Western Blot and Immunofluorescence. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
QVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIR*
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa18-110 from human DLL1 with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human DLL1.
