DNA methyltransferase 1-associated protein (DMAP1) is found in a wide variety of living organisms from yeasts to humans. MMTR is a part of the basic cellular machinery for a wide range of transcriptional regulation via interaction with TFIIH and HDAC. DMAP1 is incorporated by Bmi1 in polycomb gene silencing. The DMAP1 gene works as a mutagen for tumor suppressor genes by causing hypermethylation and subsequent TA mutations of CpG islands. The direct role of Dnmt1 is restoration of epigenetic information during DNA repair. In eukaryotes the NuA4 histone acetyltransferase (HAT) complex is highly conserved and plays primary role in transcription, cellular response to DNA damage and cell cycle control.

Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested.

Immunohistochemistry (Formalin fixed paraffin embedded): 1.5ug/ml Optimal dilutions to be determined by the researcher.

MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRPEGMHREVYALLYSDKKDAPPLLPSDTGQGYRTVKAKLGSKKVRPWKWMPF

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa1-101 from human DMAP1 (NP_061973) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified by Protein A affinity chromatography.

Recognizes human DMAP1.