Mouse Anti-DMAP1 (DNA Methyltransferase 1-Associated Protein 1, DNMAP1, DNMTAP1, DNMT1-Associated Protein 1, KIAA1425, DKFZp686L09142, EAF2, FLJ11543, SWC4)
DNA methyltransferase 1-associated protein (DMAP1) is found in a wide variety of living organisms from yeasts to humans. MMTR is a part of the basic cellular machinery for a wide range of transcriptional regulation via interaction with TFIIH and HDAC. DMAP1 is incorporated by Bmi1 in polycomb gene silencing. The DMAP1 gene works as a mutagen for tumor suppressor genes by causing hypermethylation and subsequent TA mutations of CpG islands. The direct role of Dnmt1 is restoration of epigenetic information during DNA repair. In eukaryotes the NuA4 histone acetyltransferase (HAT) complex is highly conserved and plays primary role in transcription, cellular response to DNA damage and cell cycle control.
Applications
Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested.
Recommended Dilution
Immunohistochemistry (Formalin fixed paraffin embedded): 1.5ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRPEGMHREVYALLYSDKKDAPPLLPSDTGQGYRTVKAKLGSKKVRPWKWMPF
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa1-101 from human DMAP1 (NP_061973) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human DMAP1.
