125932-FITC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
FITCIsotype
IgG1,kClone Number
2C9Grade
Affinity PurifiedApplications
FLISA IF IHC WBCrossreactivity
HuAccession #
NM_006736, NP_006727Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-DNAJB2 (DnaJ Homolog Subfamily B Member 2, DnaJ Protein Homolog 1 Heat Shock 40kD Protein 3 Heat Shock Protein J1, HSJ-1, HSJ1, HSPF3) (FITC)
DnaJB2, also known as HSJ1 or HSPF3, is belongs to the DnaJ family. It is expressed almost exclusively in the brain, with the highest levels in the frontal cortex and hippocampus. The DnaJ family is one of the largest of all the chaperone families and has evolved with diverse cellular localization and functions. The DnaJ proteins play a critical role in the HSP70 chaperone machine by interacting with HSP70 to stimulate ATP hydrolysis. DnaJB2 is important mediators of proteolysis and are involved in the regulation of protein degradation, exocytosis and endocytosis.
Applications
Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
LELSRREQQPSVTSRSGGTQVQQTPASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPAGGREAQHRRQGRPKAQHQDPGLGGTQEGARGEATKRSPSPEEKASRCLIL
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa216-324 from human DNAJB2 (NP_006727) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human DNAJB2.
