DUSP14 is involved in the inactivation of MAP kinases. This proein dephosphorylates ERK, JNK and p38 MAP-kinases. In addition to antigen recognition by the T-cell receptor, T-cell activation requires a second signal from a costimulatory receptor, such as CD28, which interacts with B7-1 (CD80) and B7-2 (CD86) ligands on antigen-presenting cells. CD28 costimulation induces transcription of interleukin-2 and stabilizes newly synthesized IL2 through the activation of mitogen-activated protein kinases (MAPKs), such as ERK and JNK, and the subsequent creation of AP1 transcription factor. DUSP14 is a negative regulator of CD28 signaling.

Suitable for use in Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Full length human DUSP14, aa1-198 (NP_008957.1).

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified by Protein A affinity chromatography.

Recognizes human DUSP14.