Rabbit Anti-DUSP22 (Dual Specificity Protein Phosphatase 22, JKAP, JNK-stimulatory Phosphatase-1, JSP1, JSP-1, Low Molecular Weight Dual Specificity Phosphatase 2, LMWDSP2, LMW-DSP2, Mitogen-activated Protein Kinase Phosphatase x, MAP Kinase Phosphatase x, MKPX, MKP-x, VHX) (Not for Export EU)
DUSP22 is member of the dual-specificity phosphatase (DSP) family, which catalyzes dephosphorylation of phosphotyrosine and phosphothreonine residues.
Applications
Suitable for use in Immunoprecipitation. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length human DUSP22, aa1-184 (NP_064570.1).
Form
Supplied as a liquid.
Specificity
Recognizes human DUSP22.
