Deoxyuridine triphosphate nucleotidohydrolase (dUTPase) is a ubiquitous enzyme that functions in the hydrolysis of dUTP to dUMP and pyrophosphate. Canman and co-workers have demonstrated that, in certain human tumor cell lines, increased levels of dUTPase are responsible for an increase in resistance to the cancer chemotherapeutic agent fluorodeoxyuridine (FUdR), a thymidine synthase inhibitor. Two distinct forms of dUTPase exist in humans. Cellular fractionation experiments suggest that the more abundant, lower mass form of dUTPase (DUT-N) localizes in the nucleus, while the higher mass form (DUT-M) is associated with the mitochondria.

Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested.

Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml Optimal dilutions to be determined by the researcher.

TDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa68-164 from human DUT (AAH33645) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.

Purified by Protein A affinity chromatography.

Recognizes human DUT.