126098-FITC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
FITCIsotype
IgG2a,kClone Number
2E8Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
BC025291, AAH25291Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-DYRK1B (Dual Specificity Tyrosine-phosphorylation-regulated Kinase 1B, Minibrain-related Kinase, Mirk Protein Kinase, MIRK) (FITC)
DYRK1B is a member of the DYRK/minibrain family of dual specificity tyrosine-regulated, arginine-directed protein kinases. It is a serine/threonine protein kinase which is expressed at elevated levels in normal skeletal muscle and certain carcinoma cell lines. It contains all motifs characteristic for the DYRK family of protein kinases. In addition, the protein also comprises a bipartite nuclear localization motif. The protein functions as a transactivator of a different transcription factor, HNF1a, to which it binds through the dimerization co-factor DcoH of HNF1a. Human DYRK1B gene is mapped to chromosome 19 (19q12-13.11).
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
DNRTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGTGAQLPPQPRYLGRPPSPTSPPPPELMDVSLV
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa479-569 from DYRK1B (AAH25291) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human DYRK1B.
