126111-ML550
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
MaxLight™550Isotype
IgG2a,kClone Number
2E10Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
NM_005225, NP_005216.1Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-E2F1 (Transcription Factor E2F1, E2F-1, PBR3, PRB-binding Protein E2F-1, RBBP-3, Retinoblastoma-associated Protein 1, RBAP-1, Retinoblastoma-binding Protein 3, RBBP3) (MaxLight 550)
MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
The E2F family of transcription factors appears to play a critical role in the transcription of certain genes required for cell cycle progression. E2F1, the first cloned member of this family, is regulated during the cell cycle at the mRNA level by changes in transcription of the E2F1 gene and at the protein level by complex formation with proteins such as the retinoblastoma gene product (pRB), cyclin A and DP1. It binds to variants of the consensus sequence TTTCGCGC, found in the promoters of a number of genes important for cell cycle progression, including c-myc, cdc2, cdc6, dihydrofolate reductase, thymidine kinase, and the E2F-1 gene itself. It plays an important role in both cell cycle regulation and apoptosis. It promotes entry into S phase and stimulates cell cycle progression. It function is regulated by the retinoblastoma protein, which binds to the transactivation domain of E2F-1 and suppresses E2F-1-mediated transcriptional activation. It exhibits dual function, can stimulate cell cycle progression as an oncogene, or can promote p53-dependent apoptosis and suppress tumorigenesis as a tumor suppressor gene. Fluorescence in situ hybridization localized E2F1 to chromosome 20q11.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
QSLLSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa348-437 from human E2F1 (NP_005216.1) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human E2F1.
