126151-FITC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
FITCIsotype
IgG2a,kClone Number
2E2Grade
Affinity PurifiedApplications
FLISA IF IHCCrossreactivity
HuAccession #
NM_014329, NP_055144Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-EDC4 (Enhancer of mRNA-decapping Protein 4, Autoantigen Ge-1, Autoantigen RCD-8, Human Enhancer of Decapping Large Subunit, Hedls, HEDLS) (FITC)
In the process of mRNA degradation, seems to play a role in mRNA decapping. Component of a complex containing DCP2 and DCP1A which functions in decapping of ARE-containing mRNAs. Promotes complex formation between DCP1A and DCP2. Enhances the catalytic activity of DCP2 (in vitro).
Applications
Suitable for use in FLISA, Immunofluorescence and Immunohistochemistry. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
PAQVFGQPPCPLSQPVLLSLIQQLASDLGTRTDLKLSYLEEAVMHLDHSDPITRDHMGSVMAQVRQKLFQFLQAEPHNSLGKAARRLSLMLHGLVTPSLP*
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1302-1402 from EDC4 (NP_055144) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human EDC4.
