Mouse Anti-EID1 (EP300-interacting Inhibitor of Differentiation 1, 21kD pRb-associated Protein, CREBBP/EP300 Inhibitory Protein 1, E1A-like Inhibitor of Differentiation 1, EID-1, C15orf3, CRI1, RBP21, PNAS-22, PTD014)
EID1 ia an acetyltransferase enzyme. It acetylates histones, giving a specific tag for transcriptional activation. EID1 also acetylates no- histone proteins, like NCOA3 coactivator. It Mediates cAMP gene regulation by binding specifically to phosphorylated CREB protein and as coactivator, augments the activity of phosphorylated CREB to activate transcription of cAMP responsive genes.
Applications
Suitable for use in Immunofluorescence and Western Blot. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length human CRI1, aa1-187 (NP_055150.1).
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human CRI1.
