126334-ML650
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
MaxLight™650Isotype
IgG2a,kClone Number
5D1Grade
Affinity PurifiedApplications
FLISA IF IHC WBCrossreactivity
HuAccession #
NM_001976, NP_001967Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-ENO3 (Enolase 3, 2-phospho-D-glycerate Hydro-lyase, beta-Enolase, Muscle-specific Enolase, MSE, Skeletal Muscle Enolase) (MaxLight 650)
MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
ENO3, is one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. ENO3 play a role in converting phosphoglyceric acid to phosphenolpyruvic acid in the glycolytic pathway. Mutations in its gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme.
Applications
Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 1.5-3ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa228-277 from human ENO3 (NP_001967) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human ENO3.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
References
1. The time course of the adaptations of human muscle proteome to bed rest and the underlying mechanisms. Brocca L, Cannavino J, Coletto L, Biolo G, Sandri M, Bottinelli R, Pellegrino MA.J Physiol. 2012 Aug 6. 2. Functional analysis of beef tenderness. Guillemin N, Bonnet M, Jurie C, Picard B.J Proteomics. 2011 Aug 9. [Epub ahead of print] 3. Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C. Uys GM, Ramburan A, Loos B, Kinnear CJ, Korkie LJ, Mouton J, Riedemann J, Moolman-Smook JC.BMC Cell Biol. 2011 May 10;12:18. 4. Proteome dynamics during contractile and metabolic differentiation of bovine foetal muscle. Chaze T, Meunier B, Chambon C, Jurie C, Picard B.Animal (2009) doi:10.1017 /S1751731 109004315. 5. Identification of alpha-Enolase as an Autoantigen in Lung Cancer: Its Overexpression Is Associated with Clinical Outcomes. Chang GC, Liu KJ, Hsieh CL, Hu TS, Charoenfuprasert S, Liu HK, Luh KT, Hsu LH, Wu CW, Ting CC, Chen CY, Chen KC, Yang TY, Chou TY, Wang WH, Whang-Peng J, Shih NY.Clin Cancer Res. 2006 Oct 1;12(19):5746-54.USBio References
No references available