126482-ML490
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
MaxLight™490Isotype
IgG2a,kClone Number
3G9-1B9Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
BC007242, AAH07242Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-ETV4 (ETS Translocation Variant 4, Polyomavirus Enhancer Activator 3 Homolog, Protein PEA3, Adenovirus E1A Enhancer-binding Protein, E1A-F, E1AF) (MaxLight 490)
MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.
ETV4 is a transcriptional activator that binds to the enhancer of the adenovirus E1A gene; the core-binding sequence is 5'[AC]GGA[AT]GT-3'.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Sandwich FLISA: The detection limit is ~0.1ng/ml as a capture antibody Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
MYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-207 from human ETV4 (AAH07242) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human ETV4.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
References
1. Overexpression of ETV4 is oncogenic in prostate cells through promotion of both cell proliferation and epithelial to mesenchymal transition. Pellecchia A, Pescucci C, De Lorenzo E, Luceri C, Passaro N, Sica M, Notaro R, De Angioletti M.Oncogenesis (2012) 1, e20; doi:10.1038/ oncsis.2012.20. 2. A fluorescence in situ hybridization screen for E26 transformation-specific aberrations: identification of DDX5-ETV4 fusion protein in prostate cancer. Han B, Mehra R, Dhanasekaran SM, Yu J, Menon A, Lonigro RJ, Wang X, Gong Y, Wang L, Shankar S, Laxman B, Shah RB, Varambally S, Palanisamy N, Tomlins SA, Kumar-Sinha C, Chinnaiyan AM.Cancer Res. 2008 Sep 15;68(18):7629-37.USBio References
No references available