Mouse Anti-FGF10 (Fibroblast Growth Factor 10, FGF-10, Keratinocyte Growth Factor 2)
Fibroblast Growth Factor-10 (also called KGF-2) is a heparin binding growth factor that stimulates the proliferation and activation of cells that express FGF receptors. FGF-10 is mostly related to FGF-7/KGF and is expressed during development and preferentially in adult lungs.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
QALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKK
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa38-137 from human FGF10 (NP_004456) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human FGF10.
