126795
Clone Type
MonoclonalHost
MouseSource
HumanIsotype
IgG1,kClone Number
1F2Grade
Affinity PurifiedApplications
E IHC WBCrossreactivity
HuAccession #
BC007044, AAH07044Shipping Temp
Blue IceStorage Temp
-20°CMouse Anti-FGG (Fibrinogen gamma chain, PRO2061, FGG)
FGG is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this protein lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia.
Applications
Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested.
Recommended Dilution
Immunohistochemistry (FFPE): 1ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
RDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHD
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant protein corresponding to aa31-130 from human FGG (AAH07044) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human FGG.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
References
1. Identification of Novel Diagnostic Biomarkers for Asthma and Chronic Obstructive Pulmonary Disease. Verrills NM, Irwin JA, He XY, Wood LG, Powell H, Simpson JL, McDonald VM, Sim A, Gibson PG.Am J Respir Crit Care Med. 2011 Mar 18. [Epub ahead of print] 2. Analysis of proteomic profiles and functional properties of human peripheral blood myeloid dendritic cells, monocyte-derived dendritic cells and the dendritic cell-like KG-1 cells reveals distinct characteristics. Horlock C, Shakib F, Mahdavi J, Jones NS, Sewell HF, Ghaemmaghami AM.Genome Biol. 2007;8(3):R30.USBio References
No references available