126830-PE
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
PEIsotype
IgG1,kClone Number
4H5-1B6Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
BC002614, AAH02614Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
BSA Free
Mouse Anti-FKBP1B (h-FKBP-12, Immunophilin FKBP12.6, 12.6kD FK506-binding Protein, 12.6kD FKBP, FKBP-12.6, Rotamase, FK506-binding Protein 1B, FKBP-1B, Peptidyl-prolyl cis-trans Isomerase FKBP1B, PPIase FKBP1B, FKBP12.6, FKBP1L, FKBP9, OTK4) (PE)
FKBP1B is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. The protein is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-80 from human FKBP1B (AAH02614) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human FKBP1B.