FKHR gene was first identified by virtue of its fusion to the PAX3 gene in the t(2;13) translocation found in the pediatric soft tissue tumor alveolar rhabdomyosarcoma . FKHR gene encodes for a protein containing a DNA-binding motif shared with members of the HNF-3:forkhead family of transcription factors. The protein acts as a potential Akt nuclear target in metabolic and survival pathways. The protein may also play a role in myogenic growth and differentiation. Human FKHR gene is usually localized in the chromosomal region 13q14.1.

Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested.

Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.

TQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa556-655 from human FOXO1A (NP_002006) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.

Purified by Protein A affinity chromatography.

Recognizes human FOXO1A.