Mouse Anti-FLVCR (Feline Leukemia Virus Subgroup C Receptor-related Protein 1, Feline Leukemia Virus Subgroup C Receptor, hFLVCR, FLVCR1)
FLVCR is responsible for exporting cytoplasmic heme. It may be required to protect developing erythroid cells from heme toxicity. It causes suceptibility to FeLV-C in vitro.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKESVELQNGPKAGTFPVNGAPRDSLAAASGVLGGPQTPLAPEEETQARLLP*
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa1-84 from human FLVCR (NP_054772) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human FLVCR.