127031-HRP
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
HRPIsotype
IgG2a,kClone Number
1A11Grade
Affinity PurifiedApplications
E WBCrossreactivity
HuAccession #
NM_012192, NP_036324Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-FXC1 (Mitochondrial Import Inner Membrane Translocase Subunit Tim10 B, Fracture Callus Protein 1, FxC1, Mitochondrial Import Inner Membrane Translocase Subunit Tim9 B, TIMM10B, Tim10b, FXC1, TIM9B, TIMM9B) (HRP)
Component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin-pore translocase that uses the membrane potential as the external driving force. In the TIM22 complex, it may act as a docking point for the soluble 70kD complex that guides the target proteins in transit through the aqueous mitochondrial intermembrane space.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
LRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS*
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa11-104 from human FXC1 (NP_036324) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human FXC1.
