Mouse Anti-G-Protein Coupled Receptor 110 (GPR110, Probable G-protein Coupled Receptor 110, G-protein Coupled Receptor KPG_012, G-protein Coupled Receptor PGR19, hGPCR36, KPG_012, PGR19)
G Protein-Coupled Receptor GPR110 is an Orphan-B GPCR with an unknown ligand. ESTs have been isolated from amnion, brain, breast, kidney, and testis libraries.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
MKVGVLWLISFFTFTDGHGGFLGKNDGIKTKKELIVNKKKHLGPVEEYQLLLQVTYRDSKEKRDLRNFLKLLKPPLLWSHGLIRIIRAKATTDCNSLNGVLQCTCEDSYTWFPPSCLDPQNCYLHTAGALPSCECHLNNLSQSVNFCERTKIWGTFKINERFTNDLLNSSSAIYSKYANGIEIQLKKAYERIQGFESVQVTQFRMSLLSPKLECNGTI
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full-length protein corresponding to aa1-218 from human GPR110, (NP_079324.2).
Form
Supplied as a liquid in PBS, pH 7.4.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human GPR110.
