Mouse Anti-GIF (Gastric Intrinsic Factor, Intrinsic Factor, IF, INF, IFMH)
Promotes absorption of the essential vitamin cobalamin (Cbl) in the ileum. After interaction with CUBN, the GIF-cobalamin complex is internalized via receptor-mediated endocytosis.
Applications
Suitable for use in ELISA, Immunofluorescence and Immunoprecipitation. Other applications not tested.
Recommended Dilutions
Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
INNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant protein corresponding to aa318-417 from human GIF (NP_005133) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4.
Specificity
Recognizes human GIF.