Glutamate receptors (GluRs) are the most important mediators of excitatory signal transduction in the central nervous system. They can be pharmacologically classified in three distinct classes: alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptors, kainate (KA) receptors, and N-methyl-D-aspartate (NMDA) receptors. The AMPA-type glutamate receptor opens in response to glutamate binding, and mediates most of the rapid excitatory postsynaptic current. The activation of AMPA receptors leads to stimulation of a multitude of biochemical pathways in postsynaptic neurones eventually leading to postsynaptic neuronal plasticity. GluR1 belongs to the family of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptors. GluR1 gene is located on human chromosome 5q33 and is expressed granule and pyramidal cells in the hippocampal formation.

Suitable for use in FLISA and Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

VVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa201-300 from human GRIA1 (NP_000818) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.

Purified by Protein A affinity chromatography.

Recognizes human GRIA1.