Mouse Anti-GMPR (Guanosine Monophosphate Reductase, Guanosine 5'-monophosphate Oxidoreductase 1, Guanosine Monophosphate Reductase 1, GMP Reductase 1, GMPR1)
Guanosine monophosphate reductase (EC 1.7.1.7) catalyzes the irreversible NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). GMPR is able to convert guanosine nucleotides to the pivotal precursor of both guanine (G) and adenine (A) nucleotides. It plays an important role in maintaining the intracellular balance of A and G nucleotides.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAV
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa1-120 from human GMPR (NP_006868) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in ascites fluid.
Specificity
Recognizes human GMPR.
