Mouse Anti-GOLPH4 (Golgi Phosphoprotein 4, Golgi Integral Membrane Protein 4, GOLIM4, Golgi Integral Membrane Protein cis, GIMPC, Golgi-localized Phosphoprotein of 130kD, Golgi Phosphoprotein of 130kD, GPP130, P138)
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi-resident protein. It may process proteins synthesized in the rough endoplasmic reticulum and assist in the transport of protein cargo through the Golgi apparatus.
Applications
Suitable for use in ELISA, Western Blot and Immunofluorescence. Other applications not tested.
Recommended Dilutions
Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
HQEQLRQQAHYDAMDNDIVQGAEDQGIQGEEGAYERDNQHQDEAEGDPGNRHEPREQGPREADPESEADRAAVEDINPADDPNNQGEDEFEEAEQV
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant protein corresponding to aa473-568 from human GOLPH4 with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human GOLPH4