Mouse Anti-GREM1 (CKTSF1B1, DAND2, DRM, Gremlin-1, Cell Proliferation-inducing Gene 2 Protein, Cysteine Knot Superfamily 1, BMP Antagonist 1, DAN Domain Family Member 2, Down-regulated in Mos-transformed Cells Protein, Increased in High Glucose Protein 2)
Gremlin-1 is a secreted cytokine that may play a role during carcinogenesis and metanephric kidney organogenesis, as a BMP antagonist required for early limb outgrowth and patterning in maintaining the FGF4-SHH feedback loop. It down-regulates the BMP4 signaling in a dose-dependent manner. It also acts as inhibitor of monocyte chemotaxis. It is highly expressed in small intestine, fetal brain and colon. Weakly expressed in brain, ovary, prostate, pancreas and skeletal muscle. In brain found in the region localized around the internal capsule in the large subcortical nuclei, including caudate, putamen, substantia nigra, thalamus and subthalamus. Predominantly expressed in normal cells including neurons, astrocytes and fibroblasts. Gremlin-1 is induced through TGF-beta 1-mediated pathways in Mesangial cell and it is down-regulated in tumor cell lines.
Applications
Suitable for use in ELISA and Western Blot. Other applications have not been tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
ESSQEALHVTERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYGQCNSFYIPRHIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant protein corresponding to aa75-184 from human GREM1 with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human GREM1.Recognizes human GREM1.
