127614-APC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
APCIsotype
IgG1,kClone Number
2G6-F6Grade
Affinity PurifiedApplications
FLISA IF IP WBCrossreactivity
HuAccession #
BC010915, AAH10915Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
BSA Free
Mouse Anti-GSTP1 (Glutathione S-transferase P, GST Class-pi, GSTP1-1, FAEES3, GST3) (APC)
Human glutathione S-transferases (GSTs) are a large multigene family of isoenzymes, which catalyse the conjugation of glutathione to electrophilic substrates. These enzymes are involved in the detoxification of both endogenous and exogenous electrophiles, which can react with cellular components such as DNA. The modification of DNA by reactive compounds can initiate carcinogenesis and the GSTs are believed to play a role in cancer prevention by inactivating carcinogens. There are four major structural classes of mammalian cytosolic GSTs (alpha, mu, pi and theta).
Applications
Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunoprecipitation. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPEFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-210 from human GSTP1 (AAH10915) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human GSTP1.