Rabbit Anti-HADH2 (Hydroxyacyl-Coenzyme A Dehydrogenase Type II, AB-binding Alcohol Dehydrogenase, ABAD, CAMR, DUPXp11.22, ERAB, HCD2, HSD17B10, MHBD, Mitochondrial Ribonuclease P Protein 2, MRPP2, MRX17, MRX31, MRXS10, SCHAD, SDR5C1, Type II HADH, Type 10 17b-HSD, Type 10 17beta-hydroxysteroid Dehydrogenase, 17b-HSD10, XH98G2)
HCD2 (Hydroxyacyl-Coenzyme A dehydrogenase) is a mitochondrial protein that catalyzes the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. ERAB is characterized as a NAD+-dependent dehydrogenase that overexpressed in neurons affected with Alzheimer's disease.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length human HSD17B10, aa1-261 (NP_004484.1).
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human HSD17B10.
