Mouse Anti-HEY1 (Hairy/Enhancer-of-split Related with YRPW Motif Protein 1, Cardiovascular Helix-loop-helix Factor 2, CHF-2, Class B Basic Helix-loop-helix Protein 31, bHLHb31, HES-related Repressor Protein 1, Hairy and Enhancer of Split-related Protein 1, HESR-1, Hairy-related Transcription Factor 1, HRT-1, hHRT1, BHLHB31, CHF2, HERP2, HESR1, HRT1)
HESR-1 belongs to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcriptional repressors. It is a downstream effector of Notch signaling which may be required for cardiovascular development. It binds preferentially to the canonical E box sequence 5\'-CACGTG-3\'. It represses transcription by the the cardiac transcriptional activators GATA4 and GATA6. HESR1 is expressed in the somitic mesoderm, the central nervous system, the kidney, the heart, nasal epithelium, and limbs.
Applications
Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested.
Recommended Dilutions
Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLG
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant protein corresponding to aa121-220 from human HEY1 with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4.
Specificity
Recognizes human HEY1.
