127952-PE
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
PEIsotype
IgG2b,kClone Number
2A1Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
NM_145899, NP_665906.1Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
BSA Free
Mouse Anti-HMGA1 (High Mobility Group Protein HMG-I/HMG-Y, HMG-I(Y), High Mobility Group AT-hook Protein 1, High Mobility Group Protein A1, High Mobility Group Protein R, HMGIY, MGC12816, MGC4242, MGC4854) (PE)
It consists of a highly conserved AT-hook DNA-binding domain that mediates binding to AT-rich sequences in the minor groove of chromosomal DNA. It functions as architectural chromatin-binding transcription factor altering the conformation of DNA by modulating nuclear protein-DNA complexes. It is involved in many cellular processes including growth regulation, viral induction of beta-IFN gene and regulation of inducible gene transcription. It also physically interacts with transcription factors such as AP-1, Sp-1 and CAAT:enhancer binding protein-beta to modulate their ability to activate gene expression. It functions as a direct transcriptional target of c-Jun and c-Myc and is maximally expressed during embryonic development. Pathological role of HMGA1 include integration of retroviruses into chromosomes and enhancing metastasis of tumor cells.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-107 from human HMGA1 (NP_665906.1) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human HMGA1.