Mouse Anti-HOXB9 (Homeobox B9, Homeobox Protein Hox-B9, Homeobox Protein Hox-2E, HOX2E, HOX2, Homeobox Protein Hox-2.5, HOX-2.5)
HOXB9 functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation, part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is expressed in whole embryos and fetuses at 5-9 weeks from conception.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
PLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEG
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length recombinant corresponding to aa65-163 from human HOXB9 (NP_076922.1) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human HOXB9.
