128061-FITC
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
FITCIsotype
IgGClone Number
4C3-G8Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
BC000578, AAH00578Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
Mouse Anti-HPRT1 (Hypoxanthine Phosphoribosyltransferase 1, HGPRT, HGPRTase, HPRT, Hypoxanthine-guanine Phosphoribosyltransferase) (FITC)
HPRT is a transferase, which catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate. HPRT, which acts as a catalyst in the reaction between guanine and phosphoribosyl pyrophosphate to form GMP, functions primarily to salvage purines from degraded DNA to renewed purine synthesis.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-218 from human HPRT1 (AAH00578) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human HPRT1.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
References
1. Sorting Nexin 27 Interacts with Multidrug Resistance-associated Protein 4 (MRP4) and Mediates Internalization of MRP4. Hayashi H, Naoi S, Nakagawa T, Nishikawa T, Fukuda H, Imajoh-Ohmi S, Kondo A, Kubo K, Yabuki T, Hattori A, Hirouchi M, Sugiyama Y.J Biol Chem. 2012 Apr 27;287(18):15054-65. Epub 2012 Mar 12.USBio References
No references available