128106-PE
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
PEIsotype
IgG2a,kClone Number
1E8Grade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
NM_000198, NP_000189.1Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
BSA Free
Mouse Anti-HSD3B2 (HSDB3B, 3 beta-hydroxysteroid Dehydrogenase/Delta 5->4-isomerase Type 2, 3 beta-hydroxysteroid Dehydrogenase/Delta 5->4-isomerase Type II, 3-beta-HSD Adrenal and Gonadal Type, 3-beta-hydroxy-Delta(5)-steroid Dehydrogenase, 3-beta-hydroxy-5-ene Steroid Dehydrogenase, Progesterone Reductase, Steroid Delta-isomerase, Delta-5-3-ketosteroid Isomerase) (PE)
The protein encoded by this gene is a bifunctional enzyme that catalyzes the oxidative conversion of delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. It plays a crucial role in the biosynthesis of all classes of hormonal steroids. This gene is predominantly expressed in the adrenals and the gonads. Mutations in this gene are associated with 3-beta-hydroxysteroid dehydrogenase, type II, deficiency. Alternatively spliced transcript variants have been found for this gene.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
ALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYT
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa33-122 from human HSD3B2 (NP_000189.1) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human HSD3B2.
