5HT1E, a Serotonin Receptor, is not well studied. It is classified as an 5-HT1-like receptor because of its ligand-binding and effector-coupling characteristics. The human 5-HT1E receptor has been studied in an African green monkey kidney cell line, in which it modulated cAMP levels upon binding serotonin. Lack of structural variants in the human gene indicate a highly conserved protein. The 5-HT1E receptor has been reported to be expressed in human cortex, caudate, putamen, and amygdala, as well as in dorsal root ganglia and in coronary artery. ESTs have been isolated from human brain cancer libraries.

Suitable for use in FLISA and Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

YHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPG

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa206-276 from human HTR1E (NP_000856.1) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified by Protein A affinity chromatography.

Recognizes human HTR1E.